PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN30238.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 275aa    MW: 30537.2 Da    PI: 8.62
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN30238.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.93e-401473261
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                +e+alkcprCdstntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rk+++s
  KHN30238.1 14 PEQALKCPRCDSTNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKKRSS 73
                6899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-281271IPR003851Zinc finger, Dof-type
PfamPF027017.7E-341672IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1891872IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102056IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MSSQSVEKKP KPHPEQALKC PRCDSTNTKF CYYNNYSLSQ PRYFCKSCRR YWTKGGTLRN  60
VPVGGGCRKK RSSSLKRAQD QTLTPNLNPL TTLPHLSYDS NDFTLAVARF QKQSSGQLGY  120
NDRDLSTLGN PTTGSFCDIL GNSGMNPSSA NPSFLDAIRT GFLETQNHLQ NLYCMYGNGD  180
LGEVDNGNSG VVGVSGEMML PYDQVIMSNA TTQSVSVMKQ EMCSRREQSE RRVLGGFPWQ  240
INADTNIGEL DSGRTIASWN SFTNSWHGFL QSPLM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572610.0DQ857261.1 Glycine max Dof11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236626.10.0Dof11
TrEMBLA0A0B2REG80.0A0A0B2REG8_GLYSO; Dof zinc finger protein DOF2.1
TrEMBLI1M4N90.0I1M4N9_SOYBN; Uncharacterized protein
STRINGGLYMA13G40420.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50263051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.12e-38TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]